PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009588530.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 284aa    MW: 32537.1 Da    PI: 6.5193
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009588530.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.11.3e-1775126556
                     SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     ++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ +q+ +WFqNrRa++k
  XP_009588530.1  75 RRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPKQIAIWFQNRRARWK 126
                     57899**********************************************9 PP

2HD-ZIP_I/II123.11.4e-3973164293
     HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     k rrl+ eqvk+LE++Fe  +kLeperK++lar+Lglqp+q+a+WFqnrRAR+ktkqlEkdy++Lkr+++a+k+en++L +++++L++++++
  XP_009588530.1  73 KIRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPKQIAIWFQNRRARWKTKQLEKDYDVLKRQLEAVKAENDSLLAHNQKLHAKIMA 164
                     669************************************************************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.7E-1965130IPR009057Homeodomain-like
PROSITE profilePS5007116.89268128IPR001356Homeobox domain
SMARTSM003892.3E-1671132IPR001356Homeobox domain
CDDcd000869.29E-1572129No hitNo description
PfamPF000465.5E-1575126IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.0E-1976135IPR009057Homeodomain-like
PRINTSPR000311.4E-599108IPR000047Helix-turn-helix motif
PROSITE patternPS000270103126IPR017970Homeobox, conserved site
PRINTSPR000311.4E-5108124IPR000047Helix-turn-helix motif
PfamPF021839.5E-14128167IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MTCTKEMAFF PPNFMLLTPH QSDHQDFQGV GSIFLGKRTM SFSGMEANNN CEENHEEEDL  60
CDDGLHEAAR EKKIRRLNME QVKTLEKNFE LGNKLEPERK MQLARALGLQ PKQIAIWFQN  120
RRARWKTKQL EKDYDVLKRQ LEAVKAENDS LLAHNQKLHA KIMALKSGEQ PTELSINLNK  180
ETEGSSSENS SEMMKLDSTM TAAAIDGPLI LVSTAHQPIT RGSRLLFPPP VRPNGVAQLF  240
QRQQVLQSDM KLMDQTVKQE TLSNMFVDDQ SPGFWPWLEQ PHFN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1120128RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2402022e-62AC240202.4 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-227k19 map 1, complete sequence.
GenBankAC2458352e-62AC245835.5 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone sle-8i3 map 1, complete sequence.
GenBankAC2467092e-62AC246709.3 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone slm-58g10 map 1, complete sequence.
GenBankHG9754402e-62HG975440.1 Solanum pennellii chromosome ch01, complete genome.
GenBankHG9755132e-62HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009588530.10.0PREDICTED: homeobox-leucine zipper protein ATHB-13-like isoform X1
SwissprotQ8LC039e-84ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLQ6L4K01e-110Q6L4K0_SOLDE; Putative DNA-binding protein
STRINGSolyc05g007180.2.11e-109(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8482498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.12e-75HD-ZIP family protein